prot_L-elsbetiae_contig9032.18061.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: A0A6H5JKP4_9PHAE (RING-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKP4_9PHAE) HSP 1 Score: 101 bits (252), Expect = 8.770e-24 Identity = 47/74 (63.51%), Postives = 55/74 (74.32%), Query Frame = 0 Query: 1 GGGGVPADEDGEDSDGLDPAHPDTCKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKVIRM 74 G GGV D+ EDSDGLDP HPDTCKIC VDILFLPC H CTCS CG+ Y GK CILCR +++ Q+VI++ Sbjct: 287 GAGGV--DDSDEDSDGLDPDHPDTCKICLDALVDILFLPCAHHCTCSRCGSAYEGKPCILCRRVVDKVQRVIKL 358
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: D7FX21_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FX21_ECTSI) HSP 1 Score: 99.4 bits (246), Expect = 2.370e-22 Identity = 42/62 (67.74%), Postives = 49/62 (79.03%), Query Frame = 0 Query: 13 DSDGLDPAHPDTCKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKVIRM 74 DSDGLDP HPDTCKIC VDILFLPC HQCTCS CG+ Y GK CILCR +++ Q+VI++ Sbjct: 955 DSDGLDPDHPDTCKICLDALVDILFLPCAHQCTCSRCGSAYEGKPCILCRRVVDKVQRVIKL 1016
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: A0A6H5J8V2_9PHAE (RING-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J8V2_9PHAE) HSP 1 Score: 95.9 bits (237), Expect = 3.910e-21 Identity = 45/67 (67.16%), Postives = 50/67 (74.63%), Query Frame = 0 Query: 8 DEDGEDSDGLDPAHPDTCKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKVIRM 74 DED DSDGLDP HPDTCKIC V ILFLPC HQCTC CG+G+ GK CI+CR + RAQ VIR+ Sbjct: 1007 DED-XDSDGLDPDHPDTCKICMDALVGILFLPCAHQCTCVRCGSGFVGKPCIICRQKVTRAQPVIRL 1072
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: UPI00117AD610 (hypothetical protein n=1 Tax=Klebsiella pneumoniae TaxID=573 RepID=UPI00117AD610) HSP 1 Score: 50.8 bits (120), Expect = 1.020e-6 Identity = 21/47 (44.68%), Postives = 27/47 (57.45%), Query Frame = 0 Query: 25 CKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKV 71 C IC +I+FLPC+H CTC+ CG G C +CR PI K+ Sbjct: 3 CIICLTSERNIVFLPCKHCCTCANCGLGL--DWCAVCREPIRELMKI 47
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: A0A6G0Z352_APHCR (Death-associated inhibitor of apoptosis 1-like n=2 Tax=Aphis TaxID=464929 RepID=A0A6G0Z352_APHCR) HSP 1 Score: 51.2 bits (121), Expect = 1.900e-5 Identity = 23/56 (41.07%), Postives = 33/56 (58.93%), Query Frame = 0 Query: 18 DPAHPDT--CKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKV 71 +P+ PD+ CKICF E++++LF+PCRH C C LC +CR P +V Sbjct: 342 EPSIPDSVVCKICFKEKLEVLFMPCRHVIACIQCAVTL--DLCAICRQPFTLTMRV 395
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: A0A2S2NQ29_SCHGA (E3 ubiquitin-protein ligase n=2 Tax=Aphidini TaxID=33387 RepID=A0A2S2NQ29_SCHGA) HSP 1 Score: 50.4 bits (119), Expect = 3.530e-5 Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 0 Query: 25 CKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKV 71 CKICF E++++LFLPCRH C C +LC +CR P +V Sbjct: 363 CKICFKEKLEVLFLPCRHVIACIQCAVTL--ELCAICRQPFTMTMRV 407
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: J9K8K1_ACYPI (Uncharacterized protein n=2 Tax=Acyrthosiphon pisum TaxID=7029 RepID=J9K8K1_ACYPI) HSP 1 Score: 50.4 bits (119), Expect = 3.580e-5 Identity = 23/56 (41.07%), Postives = 32/56 (57.14%), Query Frame = 0 Query: 18 DPAHPDT--CKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKV 71 DP+ PD+ CKICF E++++LF+PC H C C LC +CR P +V Sbjct: 449 DPSAPDSVLCKICFKEKLEVLFMPCGHVIACIQCAVTL--DLCAVCRQPFTMTMRV 502
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: UPI001C8F3C3F (hypothetical protein n=1 Tax=Klebsiella pneumoniae TaxID=573 RepID=UPI001C8F3C3F) HSP 1 Score: 47.8 bits (112), Expect = 3.640e-5 Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 0 Query: 25 CKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKV 71 C IC +I+FLPC+H CTC+ CG C +CR PI K+ Sbjct: 38 CIICLTSERNIVFLPCKHCCTCAKCGLSL--DWCAVCREPIRELMKI 82
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: UPI00100FA491 (death-associated inhibitor of apoptosis 1-like n=1 Tax=Aphis gossypii TaxID=80765 RepID=UPI00100FA491) HSP 1 Score: 49.3 bits (116), Expect = 9.070e-5 Identity = 21/47 (44.68%), Postives = 27/47 (57.45%), Query Frame = 0 Query: 25 CKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKV 71 CKICF E++++LFLPCRH C C LC +CR P +V Sbjct: 393 CKICFKEKLEVLFLPCRHVIACIQCAVTL--DLCAICRQPFTLTMRV 437 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 9
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig9032.18061.1 ID=prot_L-elsbetiae_contig9032.18061.1|Name=mRNA_L-elsbetiae_contig9032.18061.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=89bpback to top |