prot_L-elsbetiae_contig8444.17454.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8444.17454.1 vs. uniprot
Match: A0A6H5KFU5_9PHAE (RING-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFU5_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 3.890e-13 Identity = 59/93 (63.44%), Postives = 68/93 (73.12%), Query Frame = 0 Query: 1 MLGMLQATFQRVRHSCWQTGARLCDPDNPDNSGCGCXXXXXXXXXXXXXXXXXXXTSINS-----CGSRRAGLCCSWLSSLLFGWDWIPLPTS 88 MLGM+Q+ F R RH+C +TGARLC ++ + G G XXXXXXXXXXXXXXXXXXX C SRRAG CCSWLSSLL GWDW+P+ TS Sbjct: 1 MLGMIQSVFARTRHACRRTGARLCGRNSECDDGNGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCRSRRAGPCCSWLSSLLLGWDWLPIATS 93 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8444.17454.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8444.17454.1 ID=prot_L-elsbetiae_contig8444.17454.1|Name=mRNA_L-elsbetiae_contig8444.17454.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=117bpback to top |