prot_L-elsbetiae_contig8256.17260.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8256.17260.1 vs. uniprot
Match: A0A6H5JP54_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JP54_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 2.430e-13 Identity = 38/46 (82.61%), Postives = 42/46 (91.30%), Query Frame = 0 Query: 84 LAFHRMGVRQRNAPPSPPLMSALPPKRPRSPADDHDPSHGKRPRSG 129 LAFHRMGVRQRN+PPSPPL+SALPPKRPR+P DD P HGKRPR+G Sbjct: 500 LAFHRMGVRQRNSPPSPPLVSALPPKRPRTPGDD--PGHGKRPRNG 543
BLAST of mRNA_L-elsbetiae_contig8256.17260.1 vs. uniprot
Match: D7FH94_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH94_ECTSI) HSP 1 Score: 65.1 bits (157), Expect = 1.050e-11 Identity = 33/41 (80.49%), Postives = 37/41 (90.24%), Query Frame = 0 Query: 89 MGVRQRNAPPSPPLMSALPPKRPRSPADDHDPSHGKRPRSG 129 MGVRQRN+PPSPPL+SALPPKRPR+P DD P HGKRPR+G Sbjct: 1 MGVRQRNSPPSPPLVSALPPKRPRTPGDD--PGHGKRPRNG 39 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8256.17260.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8256.17260.1 ID=prot_L-elsbetiae_contig8256.17260.1|Name=mRNA_L-elsbetiae_contig8256.17260.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=130bpback to top |