prot_L-elsbetiae_contig8225.17230.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8225.17230.1 vs. uniprot
Match: A0A6H5KCU2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCU2_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 1.610e-9 Identity = 31/60 (51.67%), Postives = 40/60 (66.67%), Query Frame = 0 Query: 56 SILTGIDSEQLQVAGSPPTTYSSVQDYLQFMSHPYAYATNLELIAAQHIYGLEFRINYHG 115 SI GI SE +Q+AG P TY +V +YLQ MS P AYAT++E+ AAQ +Y L R+ G Sbjct: 215 SIFVGIISENIQIAGQPQQTYQNVPEYLQLMSVPTAYATHVEIAAAQQLYNLNIRVTLVG 274 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8225.17230.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8225.17230.1 ID=prot_L-elsbetiae_contig8225.17230.1|Name=mRNA_L-elsbetiae_contig8225.17230.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=115bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|