prot_L-elsbetiae_contig8216.17221.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8216.17221.1 vs. uniprot
Match: A0A6H5LIE2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LIE2_9PHAE) HSP 1 Score: 104 bits (259), Expect = 7.380e-26 Identity = 54/68 (79.41%), Postives = 62/68 (91.18%), Query Frame = 0 Query: 1 KGIEEGEAEGFVVVARDDKPEEGGEAGDSVDNDNSSTSGISNNIMVIVFCALAFVANGGFLVYVFWVM 68 KGIEEGEA GFVVVA D +PE G+ G+++DNDN+ST+GISNN+MVIVFCALAFVANGGFLVYVFWVM Sbjct: 196 KGIEEGEAGGFVVVAPDSEPEHRGQ-GENIDNDNASTNGISNNVMVIVFCALAFVANGGFLVYVFWVM 262
BLAST of mRNA_L-elsbetiae_contig8216.17221.1 vs. uniprot
Match: D7FR44_ECTSI (EF-hand domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FR44_ECTSI) HSP 1 Score: 99.8 bits (247), Expect = 7.540e-23 Identity = 52/67 (77.61%), Postives = 61/67 (91.04%), Query Frame = 0 Query: 1 KGIEEGEAEGFVVVARDDKPEEGGEAGDSVDNDNSSTSGISNNIMVIVFCALAFVANGGFLVYVFWV 67 KGIEEGEA GFVVVA D +P++ + G++VDNDN+ST+GISNN+MVIVFCALAFVANGGFLVYVFWV Sbjct: 62 KGIEEGEAGGFVVVAPDSEPKQR-DQGENVDNDNASTNGISNNVMVIVFCALAFVANGGFLVYVFWV 127 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8216.17221.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8216.17221.1 ID=prot_L-elsbetiae_contig8216.17221.1|Name=mRNA_L-elsbetiae_contig8216.17221.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=69bpback to top |