prot_L-elsbetiae_contig8171.17167.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8171.17167.1 vs. uniprot
Match: A0A6H5JKS3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKS3_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 1.170e-11 Identity = 37/51 (72.55%), Postives = 39/51 (76.47%), Query Frame = 0 Query: 1 LESESDLDVTEAGGPGHATLPAYKKAPAVPGTGTQGDEGSTPPSLSPGGGD 51 L SESDLD+TE GPG ATLPA + APAVPG G QGDEGS PPS GGGD Sbjct: 473 LASESDLDMTEIRGPGRATLPARENAPAVPGNGIQGDEGSAPPSPHLGGGD 523
BLAST of mRNA_L-elsbetiae_contig8171.17167.1 vs. uniprot
Match: A0A6H5L175_9PHAE (Uncharacterized protein n=9 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L175_9PHAE) HSP 1 Score: 70.9 bits (172), Expect = 1.190e-11 Identity = 37/51 (72.55%), Postives = 39/51 (76.47%), Query Frame = 0 Query: 1 LESESDLDVTEAGGPGHATLPAYKKAPAVPGTGTQGDEGSTPPSLSPGGGD 51 L SESDLD+TE GPG ATLPA + APAVPG G QGDEGS PPS GGGD Sbjct: 1029 LASESDLDMTEIRGPGRATLPARENAPAVPGNGIQGDEGSAPPSPHLGGGD 1079
BLAST of mRNA_L-elsbetiae_contig8171.17167.1 vs. uniprot
Match: A0A6H5JXX7_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXX7_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 1.180e-7 Identity = 32/50 (64.00%), Postives = 34/50 (68.00%), Query Frame = 0 Query: 2 ESESDLDVTEAGGPGHATLPAYKKAPAVPGTGTQGDEGSTPPSLSPGGGD 51 ESESDLDV EA GPG AT ++AP PG G GD GS PPSL PG GD Sbjct: 76 ESESDLDVMEARGPGQATPFVREEAPTAPGNGIPGDGGSVPPSLPPGRGD 125
BLAST of mRNA_L-elsbetiae_contig8171.17167.1 vs. uniprot
Match: A0A6H5JDW3_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JDW3_9PHAE) HSP 1 Score: 55.5 bits (132), Expect = 2.610e-6 Identity = 31/50 (62.00%), Postives = 33/50 (66.00%), Query Frame = 0 Query: 2 ESESDLDVTEAGGPGHATLPAYKKAPAVPGTGTQGDEGSTPPSLSPGGGD 51 ESESDLDV EA GPG AT ++AP PG G QGD GS PPS G GD Sbjct: 220 ESESDLDVMEARGPGQATPFVLEEAPTAPGFGIQGDGGSVPPSPPSGRGD 269
BLAST of mRNA_L-elsbetiae_contig8171.17167.1 vs. uniprot
Match: A0A6H5JMC7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMC7_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 8.040e-6 Identity = 30/50 (60.00%), Postives = 32/50 (64.00%), Query Frame = 0 Query: 2 ESESDLDVTEAGGPGHATLPAYKKAPAVPGTGTQGDEGSTPPSLSPGGGD 51 ESESDLDV EA GPG AT ++AP PG G GD GS PPS G GD Sbjct: 48 ESESDLDVMEARGPGQATPLVREEAPTAPGNGMPGDGGSVPPSPPSGKGD 97
BLAST of mRNA_L-elsbetiae_contig8171.17167.1 vs. uniprot
Match: A0A6H5JWT1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWT1_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 8.100e-6 Identity = 30/50 (60.00%), Postives = 32/50 (64.00%), Query Frame = 0 Query: 2 ESESDLDVTEAGGPGHATLPAYKKAPAVPGTGTQGDEGSTPPSLSPGGGD 51 ESESDLDV EA GPG AT ++AP PG G GD GS PPS G GD Sbjct: 48 ESESDLDVMEARGPGQATPFVREEAPTAPGNGIPGDGGSVPPSPPSGRGD 97
BLAST of mRNA_L-elsbetiae_contig8171.17167.1 vs. uniprot
Match: A0A6H5KZ59_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KZ59_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 1.190e-5 Identity = 30/50 (60.00%), Postives = 32/50 (64.00%), Query Frame = 0 Query: 2 ESESDLDVTEAGGPGHATLPAYKKAPAVPGTGTQGDEGSTPPSLSPGGGD 51 ESESDLDV EA GPG AT ++AP PG G GD GS PPS G GD Sbjct: 357 ESESDLDVVEARGPGQATPFVPEEAPTAPGNGIPGDGGSVPPSPPSGRGD 406
BLAST of mRNA_L-elsbetiae_contig8171.17167.1 vs. uniprot
Match: A0A6H5K0G8_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0G8_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 1.270e-5 Identity = 30/50 (60.00%), Postives = 32/50 (64.00%), Query Frame = 0 Query: 2 ESESDLDVTEAGGPGHATLPAYKKAPAVPGTGTQGDEGSTPPSLSPGGGD 51 ESESDLDV EA GPG AT ++AP PG G GD GS PPS G GD Sbjct: 458 ESESDLDVMEARGPGQATPFVREEAPTAPGNGIPGDGGSVPPSPPSGRGD 507
BLAST of mRNA_L-elsbetiae_contig8171.17167.1 vs. uniprot
Match: A0A6H5JI74_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JI74_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 1.290e-5 Identity = 30/50 (60.00%), Postives = 32/50 (64.00%), Query Frame = 0 Query: 2 ESESDLDVTEAGGPGHATLPAYKKAPAVPGTGTQGDEGSTPPSLSPGGGD 51 ESESDLDV EA GPG AT ++AP PG G GD GS PPS G GD Sbjct: 238 ESESDLDVMEARGPGQATPFVGEEAPTAPGNGIPGDGGSVPPSSPSGRGD 287
BLAST of mRNA_L-elsbetiae_contig8171.17167.1 vs. uniprot
Match: A0A6H5KBK7_9PHAE (CCHC-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KBK7_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 1.300e-5 Identity = 30/50 (60.00%), Postives = 32/50 (64.00%), Query Frame = 0 Query: 2 ESESDLDVTEAGGPGHATLPAYKKAPAVPGTGTQGDEGSTPPSLSPGGGD 51 ESESDLDV EA GPG AT ++AP PG G GD GS PPS G GD Sbjct: 469 ESESDLDVMEARGPGQATPFVREEAPTAPGNGIPGDGGSVPPSPPSGRGD 518 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8171.17167.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 13
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8171.17167.1 ID=prot_L-elsbetiae_contig8171.17167.1|Name=mRNA_L-elsbetiae_contig8171.17167.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=132bpback to top |