prot_L-elsbetiae_contig807.17062.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig807.17062.1 vs. uniprot
Match: D7FGR5_ECTSI (Transcription factor prr1 (Pombe response regulator 1) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FGR5_ECTSI) HSP 1 Score: 149 bits (375), Expect = 3.060e-40 Identity = 76/97 (78.35%), Postives = 84/97 (86.60%), Query Frame = 0 Query: 19 GMRMEFWEKARKRRTMSTQLVFPGQPPENTKDIDQPDPSLCDVMDVICQCMEVRNSSSESQQSQLSAFSGCSFNMDSLRRSSISDLLNCMSWESALR 115 GMRM +WEK RKRRT+S QLVFP QPP NT+ IDQPDPSLCDVMDVICQCMEV++SS +SQLSA SGCSF +S+RRSSISDLLNCMSWESALR Sbjct: 255 GMRMAYWEKNRKRRTLSAQLVFPVQPPNNTETIDQPDPSLCDVMDVICQCMEVQSSS----ESQLSALSGCSFKRESMRRSSISDLLNCMSWESALR 347 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig807.17062.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig807.17062.1 ID=prot_L-elsbetiae_contig807.17062.1|Name=mRNA_L-elsbetiae_contig807.17062.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=115bpback to top |