prot_L-elsbetiae_contig8.16979.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8.16979.1 vs. uniprot
Match: D8LBG9_ECTSI (NADPH:adrenodoxin oxidoreductase, mitochondrial n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBG9_ECTSI) HSP 1 Score: 56.2 bits (134), Expect = 8.450e-8 Identity = 34/46 (73.91%), Postives = 36/46 (78.26%), Query Frame = 0 Query: 1 CTAGR-ARTAIVRGKATAAAPAGRPLRVCVVGSGPAGFYVTKYLLK 45 C + R A TAI R AT + AGRPLRVCVVGSGPAGFYVTKYLLK Sbjct: 33 CVSARTAGTAIQRPTATDVS-AGRPLRVCVVGSGPAGFYVTKYLLK 77
BLAST of mRNA_L-elsbetiae_contig8.16979.1 vs. uniprot
Match: A0A6H5L1K8_9PHAE (Pyr_redox_2 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L1K8_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 2.120e-7 Identity = 25/25 (100.00%), Postives = 25/25 (100.00%), Query Frame = 0 Query: 21 AGRPLRVCVVGSGPAGFYVTKYLLK 45 AGRPLRVCVVGSGPAGFYVTKYLLK Sbjct: 53 AGRPLRVCVVGSGPAGFYVTKYLLK 77
BLAST of mRNA_L-elsbetiae_contig8.16979.1 vs. uniprot
Match: A0A835ZC91_9STRA (NADPH:adrenodoxin oxidoreductase, mitochondrial n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZC91_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 6.090e-5 Identity = 21/22 (95.45%), Postives = 21/22 (95.45%), Query Frame = 0 Query: 24 PLRVCVVGSGPAGFYVTKYLLK 45 PLRVCVVGSGPAGFY TKYLLK Sbjct: 53 PLRVCVVGSGPAGFYTTKYLLK 74 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8.16979.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig8.16979.1 ID=prot_L-elsbetiae_contig8.16979.1|Name=mRNA_L-elsbetiae_contig8.16979.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=55bpback to top |