prot_L-elsbetiae_contig772.16664.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig772.16664.1 vs. uniprot
Match: A0A6H5K1C2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K1C2_9PHAE) HSP 1 Score: 69.7 bits (169), Expect = 2.170e-11 Identity = 53/84 (63.10%), Postives = 60/84 (71.43%), Query Frame = 0 Query: 2 AIVLAGVGSLFSILAPKVLRAKHELEGKALVGPSAVV----TGP--SGS-GDALFGIERGELGGDGGDGP-PRTSTPSGVSSVG 77 AI+LAGVG LF +L ++LRAK ELEGKALV PSA TGP SGS GDAL G+ GE DG + P PRT+TPSGVSSVG Sbjct: 33 AILLAGVGVLFPVLGTRLLRAKQELEGKALVAPSAAAAAAATGPGTSGSVGDALRGV--GERAMDGDEYPEPRTTTPSGVSSVG 114
BLAST of mRNA_L-elsbetiae_contig772.16664.1 vs. uniprot
Match: D7FH00_ECTSI (G_PROTEIN_RECEP_F3_4 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH00_ECTSI) HSP 1 Score: 66.2 bits (160), Expect = 3.570e-10 Identity = 49/77 (63.64%), Postives = 56/77 (72.73%), Query Frame = 0 Query: 2 AIVLAGVGSLFSILAPKVLRAKHELEGKALVGPSAVV--TGPS--GS-GDALFGIERGELGGDGGDGP-PRTSTPSG 72 AI+LAGVG LF +L +VLRAK ELEGKALVGPSA TGP GS GDAL+G+ GE DG + P PRT+TPSG Sbjct: 316 AILLAGVGVLFPVLGTRVLRAKQELEGKALVGPSAAAAATGPGTGGSVGDALYGV--GERAMDGDEYPEPRTTTPSG 390 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig772.16664.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig772.16664.1 ID=prot_L-elsbetiae_contig772.16664.1|Name=mRNA_L-elsbetiae_contig772.16664.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=124bpback to top |