prot_L-elsbetiae_contig7620.16543.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7620.16543.1 vs. uniprot
Match: A0A6H5K3H5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3H5_9PHAE) HSP 1 Score: 99.0 bits (245), Expect = 3.430e-24 Identity = 46/86 (53.49%), Postives = 63/86 (73.26%), Query Frame = 0 Query: 4 QVRALLENVEVKGGVLDCCGATNDAVRTVLTANGLRVATNDLDSRLIADTHLDAATNTFVDAYSEDSRRPNWVVSSPSYKNAFGIL 89 +V ALL NV++ GGVLD CG+ +DA++ VL A+ L V+TND + RL ADTHLDA + F +S + +RP+W+V+SP Y NAF IL Sbjct: 14 KVDALLLNVKLAGGVLDACGSASDAIKVVLEAHSLNVSTNDFNPRLTADTHLDATSEEFTAMFSTEGQRPDWIVTSPPYGNAFSIL 99
BLAST of mRNA_L-elsbetiae_contig7620.16543.1 vs. uniprot
Match: A0A6H5KD58_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KD58_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 3.590e-12 Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 0 Query: 5 VRALLENVEVKGGVLDCCGATNDAVRTVLTANGLRVATNDLDSRLIADTHLDAATNTFVDAY--SEDSRRPNWVVSSPSYKNAFGILK 90 V ALL V + G +LD CG DAV T L V TND+ S ADT+LDA+ +F D + + +RP+WVV+SPSYK+A +K Sbjct: 103 VEALLGAVSITGCILDVCGGPTDAVATRLGPT-CEVLTNDVSSGRPADTNLDASLESFPDDFFAASSGKRPDWVVTSPSYKSALTFVK 189 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7620.16543.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7620.16543.1 ID=prot_L-elsbetiae_contig7620.16543.1|Name=mRNA_L-elsbetiae_contig7620.16543.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=91bpback to top |