prot_L-elsbetiae_contig760.16510.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig760.16510.1 vs. uniprot
Match: A0A6H5KEN8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KEN8_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 2.450e-6 Identity = 47/109 (43.12%), Postives = 57/109 (52.29%), Query Frame = 0 Query: 9 RQLDLASSFKAGQRAQSDSARKRSRTAADAXXXXXXXXXXXXXXTQIEAATAHHA-GRPSERRTMSRGDLGGIGVSEAGDDLGVSPGSTDVLTKRKAGDDAVGAGAPYR 116 RQLDLASSFKAG A S+S R+ + A ++ A A +PSE M RG+LG IGVSEAGDDLG+ P + KRKAG D G P + Sbjct: 100 RQLDLASSFKAG--ALSESTRQGNTLIWLAWGWAAEYCHFVAGASRGGAGGGGAAKAKPSEG--MDRGELGAIGVSEAGDDLGI-PTAPGRPAKRKAGSDTAGTSTPAK 203 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig760.16510.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig760.16510.1 ID=prot_L-elsbetiae_contig760.16510.1|Name=mRNA_L-elsbetiae_contig760.16510.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=119bpback to top |