prot_L-elsbetiae_contig7557.16453.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7557.16453.1 vs. uniprot
Match: D7FNA1_ECTSI (PPR_long domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNA1_ECTSI) HSP 1 Score: 87.4 bits (215), Expect = 5.660e-19 Identity = 38/44 (86.36%), Postives = 40/44 (90.91%), Query Frame = 0 Query: 1 QVQRLSWFANWFDSLEDPPTAIIDGPNAGYMGQNFPEGGFSLTQ 44 +VQRLSWFANWF SLEDPPTAIIDGPN G+M QNF EGGFSLTQ Sbjct: 513 EVQRLSWFANWFCSLEDPPTAIIDGPNVGFMNQNFKEGGFSLTQ 556
BLAST of mRNA_L-elsbetiae_contig7557.16453.1 vs. uniprot
Match: A0A6H5JYJ8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYJ8_9PHAE) HSP 1 Score: 81.6 bits (200), Expect = 1.520e-17 Identity = 36/44 (81.82%), Postives = 37/44 (84.09%), Query Frame = 0 Query: 2 VQRLSWFANWFDSLEDPPTAIIDGPNAGYMGQNFPEGGFSLTQA 45 VQRLSWFANWF SLEDPPTAIIDGPN G+M QNF GG S TQA Sbjct: 174 VQRLSWFANWFCSLEDPPTAIIDGPNVGFMNQNFKGGGLSFTQA 217 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7557.16453.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7557.16453.1 ID=prot_L-elsbetiae_contig7557.16453.1|Name=mRNA_L-elsbetiae_contig7557.16453.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=45bpback to top |