prot_L-elsbetiae_contig7229.16084.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7229.16084.1 vs. uniprot
Match: A0A6H5JT00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT00_9PHAE) HSP 1 Score: 55.8 bits (133), Expect = 2.290e-5 Identity = 21/39 (53.85%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 29 GGRQKQCGHPGCTTQPSFGMTGSTKRQYCSKHAKRGMVS 67 G R QCGH CT +P++G+ GS KR++CS+HA+ GMV+ Sbjct: 58 GSRMSQCGHENCTKRPTYGVAGSKKREFCSQHARDGMVN 96
BLAST of mRNA_L-elsbetiae_contig7229.16084.1 vs. uniprot
Match: A0A6H5KRV0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRV0_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 4.630e-5 Identity = 22/35 (62.86%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 33 KQCGHPGCTTQPSFGMTGSTKRQYCSKHAKRGMVS 67 K CGHPGC +PSFG GSTK ++CS+HA +GMV+ Sbjct: 35 KGCGHPGCIKRPSFGNDGSTKAEFCSQHAWKGMVN 69 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7229.16084.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7229.16084.1 ID=prot_L-elsbetiae_contig7229.16084.1|Name=mRNA_L-elsbetiae_contig7229.16084.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=255bpback to top |