prot_L-elsbetiae_contig7188.16024.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7188.16024.1 vs. uniprot
Match: A0A6H5L740_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L740_9PHAE) HSP 1 Score: 55.5 bits (132), Expect = 1.630e-7 Identity = 24/42 (57.14%), Postives = 29/42 (69.05%), Query Frame = 0 Query: 13 LQVQVDHCLPDSCKHPCVSAVGSCCGPEGMGGFGSPRETAAP 54 +QVQVDHC+ CKHPCVSAVG CCGP M +P+ +P Sbjct: 191 IQVQVDHCVDSRCKHPCVSAVGGCCGPTAMSARPAPQCALSP 232
BLAST of mRNA_L-elsbetiae_contig7188.16024.1 vs. uniprot
Match: D7FQH9_ECTSI (Cation efflux family protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQH9_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 1.150e-6 Identity = 22/37 (59.46%), Postives = 27/37 (72.97%), Query Frame = 0 Query: 13 LQVQVDHCLPDSCKHPCVSAVGSCCGPEGMGGFGSPR 49 +QVQVDHC+ CKHPCVSAVG CCGP + +P+ Sbjct: 475 IQVQVDHCVDSRCKHPCVSAVGGCCGPTAISARPAPQ 511 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7188.16024.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7188.16024.1 ID=prot_L-elsbetiae_contig7188.16024.1|Name=mRNA_L-elsbetiae_contig7188.16024.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=65bpback to top |