prot_L-elsbetiae_contig699.15772.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig699.15772.1 vs. uniprot
Match: D7G490_ECTSI (Dhm exonuclease n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G490_ECTSI) HSP 1 Score: 57.4 bits (137), Expect = 1.970e-7 Identity = 52/104 (50.00%), Postives = 63/104 (60.58%), Query Frame = 0 Query: 1 MAPRRPLCSGDQGNSGHACPAASRPPSCWRKARRAGSS-GGR---VVTLAVGLLCSSTAPTPAFGFFLPGAAVSPSGRSAGGNSMGVGGGRAVGVSSLRSSFAG 100 MA RR L + +G S H A R S R R+ G S GGR +++AVGLL SST+P PA F LPGA VS S +SMG+G G A+G+SS RSSFAG Sbjct: 6 MASRR-LYAEKKGQSSHQDSEALRLASTGRNMRKRGRSHGGRHSLALSIAVGLLRSSTSPAPACAFLLPGA-VSRS------SSMGLGSGSAIGISSGRSSFAG 101 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig699.15772.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig699.15772.1 ID=prot_L-elsbetiae_contig699.15772.1|Name=mRNA_L-elsbetiae_contig699.15772.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=100bpback to top |