prot_L-elsbetiae_contig6861.15618.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6861.15618.1 vs. uniprot
Match: A0A6H5KXM6_9PHAE (SH2 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXM6_9PHAE) HSP 1 Score: 101 bits (252), Expect = 5.480e-23 Identity = 47/81 (58.02%), Postives = 60/81 (74.07%), Query Frame = 0 Query: 1 MCCSRRLNVVELNPNNED---------DSYGAFAGSDIVLALRGHPGCVQDLCRCPLVHEERGLLLHRKVLLEKIIPELQE 72 MCCSR L+V E+ P+ + DSY +FA SDIVLALRGHPGCVQDLCRCP VHEE+GL++HR+ LL + IP+ ++ Sbjct: 623 MCCSRNLSVCEMGPSKPEPFTGTEGKADSYESFAKSDIVLALRGHPGCVQDLCRCPRVHEEKGLIVHREKLLREDIPKARK 703
BLAST of mRNA_L-elsbetiae_contig6861.15618.1 vs. uniprot
Match: D8LEZ2_ECTSI (SH2 domain containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LEZ2_ECTSI) HSP 1 Score: 101 bits (251), Expect = 7.340e-23 Identity = 47/78 (60.26%), Postives = 58/78 (74.36%), Query Frame = 0 Query: 1 MCCSRRLNVVELNPNNED---------DSYGAFAGSDIVLALRGHPGCVQDLCRCPLVHEERGLLLHRKVLLEKIIPE 69 MCCSR L+V E+ P+ + DSY +FA SDIVLALRGHPGCVQDLCRCP VHEE+GL++HR+ LL + IP+ Sbjct: 395 MCCSRNLSVCEMGPSKPEPFTGTEGKADSYESFAKSDIVLALRGHPGCVQDLCRCPRVHEEKGLIVHREKLLREDIPK 472 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6861.15618.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6861.15618.1 ID=prot_L-elsbetiae_contig6861.15618.1|Name=mRNA_L-elsbetiae_contig6861.15618.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=99bpback to top |