prot_L-elsbetiae_contig6488.15166.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6488.15166.1 vs. uniprot
Match: A0A6H5L0K3_9PHAE (Serine/threonine-protein phosphatase n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0K3_9PHAE) HSP 1 Score: 105 bits (263), Expect = 1.420e-23 Identity = 46/63 (73.02%), Postives = 51/63 (80.95%), Query Frame = 0 Query: 94 CCGLCGYTLEEGQRVVRSPSCSEGLLLHHGCFD--DSGVVFSDDADAGRLKFGCDCGQFHSGL 154 CC LCGYTLEEGQRVVRSP C EGL++H CF+ DS VFSDD+D G LKFGCDCGQFH G+ Sbjct: 252 CCCLCGYTLEEGQRVVRSPECGEGLMVHQACFESEDSTPVFSDDSDGGALKFGCDCGQFHPGV 314
BLAST of mRNA_L-elsbetiae_contig6488.15166.1 vs. uniprot
Match: D7FN84_ECTSI (Serine/threonine-protein phosphatase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FN84_ECTSI) HSP 1 Score: 102 bits (253), Expect = 1.290e-22 Identity = 48/78 (61.54%), Postives = 56/78 (71.79%), Query Frame = 0 Query: 80 EGADEPVLMGGEGSCCG-LCGYTLEEGQRVVRSPSCSEGLLLHHGCFD--DSGVVFSDDADAGRLKFGCDCGQFHSGL 154 E A P+ G C LCGYT+EEGQRVVRSP C+EGL++H CF+ DS VFSDD+D G LKFGCDCGQFH G+ Sbjct: 19 EQAPAPMSSATGGDCXXXLCGYTIEEGQRVVRSPECAEGLMVHQACFESEDSTPVFSDDSDGGALKFGCDCGQFHPGV 96 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6488.15166.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6488.15166.1 ID=prot_L-elsbetiae_contig6488.15166.1|Name=mRNA_L-elsbetiae_contig6488.15166.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=154bpback to top |