prot_L-elsbetiae_contig6453.15125.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6453.15125.1 vs. uniprot
Match: D7FHQ5_ECTSI (FCP1 homology domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHQ5_ECTSI) HSP 1 Score: 100 bits (249), Expect = 8.890e-23 Identity = 61/99 (61.62%), Postives = 70/99 (70.71%), Query Frame = 0 Query: 4 LDPVDNDAAARRRSSVMKLPDNLRALVQQSDASGVQQKTPQPYSPQAGS--KAPTTPATGTSS---LNNTGGSTASASGPNK--WMAHVLAFIRWKRLP 95 +DP D DA ARRRSSVMKLPDNLRALVQQSDASGVQ+KT PY+PQ S KA TT T LNNTG STAS W+++V+ FIRWK++P Sbjct: 156 VDPADADAVARRRSSVMKLPDNLRALVQQSDASGVQKKTESPYNPQGASDDKAQTTTTDNTXXXXXLNNTGSSTASTGSTRGRGWLSNVMTFIRWKKVP 254 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6453.15125.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6453.15125.1 ID=prot_L-elsbetiae_contig6453.15125.1|Name=mRNA_L-elsbetiae_contig6453.15125.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=97bpback to top |