prot_L-elsbetiae_contig6333.14985.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6333.14985.1 vs. uniprot
Match: A0A7J6PGT2_PEROL (Uncharacterized protein n=2 Tax=Perkinsus olseni TaxID=32597 RepID=A0A7J6PGT2_PEROL) HSP 1 Score: 58.5 bits (140), Expect = 1.130e-8 Identity = 24/41 (58.54%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 2 HRRALTCRLCQQRFFPASLKFHVKVCAQRHEHVELPCEHCD 42 HRRA+ C C Q FFP SL+FH+K C + +HVELPC CD Sbjct: 9 HRRAVPCPSCGQHFFPQSLRFHLKSCVVKQQHVELPCPFCD 49
BLAST of mRNA_L-elsbetiae_contig6333.14985.1 vs. uniprot
Match: A0A7J6U944_PEROL (Uncharacterized protein n=1 Tax=Perkinsus olseni TaxID=32597 RepID=A0A7J6U944_PEROL) HSP 1 Score: 58.5 bits (140), Expect = 1.140e-8 Identity = 24/41 (58.54%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 2 HRRALTCRLCQQRFFPASLKFHVKVCAQRHEHVELPCEHCD 42 HRRA+ C C Q FFP SL+FH+K C + +HVELPC CD Sbjct: 9 HRRAVPCPSCGQHFFPQSLRFHLKSCVVKQQHVELPCPFCD 49
BLAST of mRNA_L-elsbetiae_contig6333.14985.1 vs. uniprot
Match: A0A7J6LKF5_PEROL (Uncharacterized protein n=2 Tax=Perkinsus olseni TaxID=32597 RepID=A0A7J6LKF5_PEROL) HSP 1 Score: 58.5 bits (140), Expect = 1.140e-8 Identity = 24/41 (58.54%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 2 HRRALTCRLCQQRFFPASLKFHVKVCAQRHEHVELPCEHCD 42 HRRA+ C C Q FFP SL+FH+K C + +HVELPC CD Sbjct: 9 HRRAVPCPSCGQHFFPQSLRFHLKSCVVKQQHVELPCPFCD 49
BLAST of mRNA_L-elsbetiae_contig6333.14985.1 vs. uniprot
Match: A0A7J6MXE7_PERCH (Uncharacterized protein n=1 Tax=Perkinsus chesapeaki TaxID=330153 RepID=A0A7J6MXE7_PERCH) HSP 1 Score: 58.2 bits (139), Expect = 1.550e-8 Identity = 24/41 (58.54%), Postives = 29/41 (70.73%), Query Frame = 0 Query: 2 HRRALTCRLCQQRFFPASLKFHVKVCAQRHEHVELPCEHCD 42 HRRA+ C C Q FFP SL+FH+K C + +HVELPC CD Sbjct: 9 HRRAVPCPSCGQNFFPQSLRFHLKSCIVKQQHVELPCPFCD 49
BLAST of mRNA_L-elsbetiae_contig6333.14985.1 vs. uniprot
Match: A0A7S3IZW6_9SPIT (Hypothetical protein (Fragment) n=1 Tax=Euplotes harpa TaxID=151035 RepID=A0A7S3IZW6_9SPIT) HSP 1 Score: 53.9 bits (128), Expect = 5.470e-8 Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 0 Query: 4 RALTCRLCQQRFFPASLKFHVKVCAQRHEHVELPCEHCDERF 45 RA+TC++C Q+FFPAS+KFH K C ++ E C HC ++ Sbjct: 10 RAITCKICNQKFFPASMKFHKKECQKKFEGTHSKCTHCGQKI 51
BLAST of mRNA_L-elsbetiae_contig6333.14985.1 vs. uniprot
Match: A0A7S4NRQ2_GUITH (Hypothetical protein (Fragment) n=1 Tax=Guillardia theta TaxID=55529 RepID=A0A7S4NRQ2_GUITH) HSP 1 Score: 52.8 bits (125), Expect = 2.710e-7 Identity = 21/43 (48.84%), Postives = 29/43 (67.44%), Query Frame = 0 Query: 4 RALTCRLCQQRFFPASLKFHVKVCAQRHEHVELPCEHCDERFP 46 R++TC +C Q+FF ASL FHVK C + + + +PC CD FP Sbjct: 9 RSVTCTMCGQQFFKASLPFHVKQCRLKTDAIPIPCPGCDREFP 51
BLAST of mRNA_L-elsbetiae_contig6333.14985.1 vs. uniprot
Match: A0A7S1HGX3_HEMAN (Hypothetical protein (Fragment) n=2 Tax=Hemiselmis andersenii TaxID=464988 RepID=A0A7S1HGX3_HEMAN) HSP 1 Score: 47.8 bits (112), Expect = 5.180e-5 Identity = 20/43 (46.51%), Postives = 28/43 (65.12%), Query Frame = 0 Query: 4 RALTCRLCQQRFFPASLKFHVKVCAQRHEHVELPCEHCDERFP 46 RA+TC++C Q FF ASL FH+K C + V +PC C+ +P Sbjct: 5 RAVTCQMCGQGFFKASLPFHLKQCQIKSAAVPIPCPGCNVEYP 47 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6333.14985.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6333.14985.1 ID=prot_L-elsbetiae_contig6333.14985.1|Name=mRNA_L-elsbetiae_contig6333.14985.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=52bpback to top |