prot_L-elsbetiae_contig631.14951.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig631.14951.1 vs. uniprot
Match: D7G047_ECTSI (Topo_C_assoc domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G047_ECTSI) HSP 1 Score: 78.2 bits (191), Expect = 1.840e-16 Identity = 35/43 (81.40%), Postives = 39/43 (90.70%), Query Frame = 0 Query: 1 QVFAKTLRDKFVWAMNVPPDWSFSYETLLNSKQSALDVPPLPG 43 +VFAKTL++KFVWAMNVPPDW+FSYETL NSKQS LDVP PG Sbjct: 19 KVFAKTLQNKFVWAMNVPPDWNFSYETLYNSKQSVLDVPRPPG 61
BLAST of mRNA_L-elsbetiae_contig631.14951.1 vs. uniprot
Match: D7G042_ECTSI (TOPEUc domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G042_ECTSI) HSP 1 Score: 79.7 bits (195), Expect = 3.360e-15 Identity = 36/48 (75.00%), Postives = 40/48 (83.33%), Query Frame = 0 Query: 1 QVFAKTLRDKFVWAMNVPPDWSFSYETLLNSKQSALDVPPLPGSGKKK 48 +VFAKTL++KFVWAMNVPPDW+FSYETL NSKQS LDVP PG K Sbjct: 937 RVFAKTLQNKFVWAMNVPPDWNFSYETLYNSKQSVLDVPRPPGGASPK 984
BLAST of mRNA_L-elsbetiae_contig631.14951.1 vs. uniprot
Match: A0A6H5K298_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K298_9PHAE) HSP 1 Score: 71.2 bits (173), Expect = 1.840e-12 Identity = 31/40 (77.50%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 4 AKTLRDKFVWAMNVPPDWSFSYETLLNSKQSALDVPPLPG 43 ++ LRDKF WAMNVPPDW+FSYETL NSKQS LDVP PG Sbjct: 93 SRRLRDKFAWAMNVPPDWNFSYETLYNSKQSVLDVPRPPG 132
BLAST of mRNA_L-elsbetiae_contig631.14951.1 vs. uniprot
Match: A0A836C9X0_9STRA (DNA topoisomerase I n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836C9X0_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 6.510e-8 Identity = 25/39 (64.10%), Postives = 29/39 (74.36%), Query Frame = 0 Query: 1 QVFAKTLRDKFVWAMNVPPDWSFSYETLLNSKQSALDVP 39 ++FAKTLRDKFVWAMNVPPDW F +ETL + D P Sbjct: 631 RIFAKTLRDKFVWAMNVPPDWRFDFETLRAVTAESSDEP 669 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig631.14951.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig631.14951.1 ID=prot_L-elsbetiae_contig631.14951.1|Name=mRNA_L-elsbetiae_contig631.14951.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=104bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|