prot_L-elsbetiae_contig6260.14865.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6260.14865.1 vs. uniprot
Match: D8LM00_ECTSI (Zn(2)-C6 fungal-type domain-containing protein (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LM00_ECTSI) HSP 1 Score: 89.7 bits (221), Expect = 9.340e-17 Identity = 53/68 (77.94%), Postives = 54/68 (79.41%), Query Frame = 0 Query: 22 LPGVKGLVSPFPATAAAG------EKPRPKENEDAKQLAVETLLGLKNSQGSKGGAPMDEASAQAMVA 83 LPGVKGL P PA AA EKPR KENEDAKQLAVETLLGLKNSQGSKGG PMDEASAQA+VA Sbjct: 716 LPGVKGLALP-PAVAAXXXXXXXXEKPRRKENEDAKQLAVETLLGLKNSQGSKGGGPMDEASAQAVVA 782
BLAST of mRNA_L-elsbetiae_contig6260.14865.1 vs. uniprot
Match: A0A6H5JM19_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JM19_9PHAE) HSP 1 Score: 80.1 bits (196), Expect = 1.930e-13 Identity = 41/44 (93.18%), Postives = 42/44 (95.45%), Query Frame = 0 Query: 40 EKPRPKENEDAKQLAVETLLGLKNSQGSKGGAPMDEASAQAMVA 83 EKPR KENEDAKQLAVETLLGLKNSQGSKGG PMDEASAQA+VA Sbjct: 753 EKPRRKENEDAKQLAVETLLGLKNSQGSKGGGPMDEASAQAVVA 796 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6260.14865.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6260.14865.1 ID=prot_L-elsbetiae_contig6260.14865.1|Name=mRNA_L-elsbetiae_contig6260.14865.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=250bpback to top |