prot_L-elsbetiae_contig5849.14302.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5849.14302.1 vs. uniprot
Match: A0A6H5K8B2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K8B2_9PHAE) HSP 1 Score: 127 bits (318), Expect = 2.150e-26 Identity = 62/87 (71.26%), Postives = 72/87 (82.76%), Query Frame = 0 Query: 2 SGGRGLPLSEMPSCPGRFVLRGTCCGTPANKNSAARSKHNVRTALEGFEALGGVRGVWLRGEEAILVGDHEATWGLLGELYRRHGRI 88 SGGRGLPLSE+PSCPGRFVL+GTC G PAN AAR+KHNVR+AL F ALGG+ G WLRGE AIL GDHEATWGL+ ++Y+R R+ Sbjct: 487 SGGRGLPLSEIPSCPGRFVLKGTC-GAPAN---AARAKHNVRSALSAFAALGGIGGTWLRGETAILEGDHEATWGLIYDVYKRVRRV 569 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5849.14302.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5849.14302.1 ID=prot_L-elsbetiae_contig5849.14302.1|Name=mRNA_L-elsbetiae_contig5849.14302.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=703bpback to top |