prot_L-elsbetiae_contig5720.14113.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5720.14113.1 vs. uniprot
Match: A0A6H5K450_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K450_9PHAE) HSP 1 Score: 87.4 bits (215), Expect = 3.870e-17 Identity = 45/70 (64.29%), Postives = 56/70 (80.00%), Query Frame = 0 Query: 86 AAAAAAHWVLLTDAALYIIET-GVAGAAAGAG-SNKSSDSLCRLERHRVWSLSLPLETRALPNGDEVAVR 153 A A AAHW+LLTD A+Y++ET G+ AA G + + ++ LC L+RHR+WSLSLPLETRALPNGDEVAVR Sbjct: 808 APATAAHWILLTDGAMYVVETRGIGAAAEGERPAARETNGLCCLKRHRLWSLSLPLETRALPNGDEVAVR 877
BLAST of mRNA_L-elsbetiae_contig5720.14113.1 vs. uniprot
Match: D8LKM4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LKM4_ECTSI) HSP 1 Score: 86.3 bits (212), Expect = 6.140e-17 Identity = 44/70 (62.86%), Postives = 55/70 (78.57%), Query Frame = 0 Query: 86 AAAAAAHWVLLTDAALYIIETGVAGAAAGAG--SNKSSDSLCRLERHRVWSLSLPLETRALPNGDEVAVR 153 A A AAHW+LLTD A+Y++ET GAAA + + ++ LC L+RHR+WSLSLPLETRALPNGDE+AVR Sbjct: 139 APATAAHWILLTDGAMYVVETRGLGAAAEGERPAARETNGLCCLKRHRLWSLSLPLETRALPNGDEMAVR 208 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5720.14113.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5720.14113.1 ID=prot_L-elsbetiae_contig5720.14113.1|Name=mRNA_L-elsbetiae_contig5720.14113.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=153bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|