prot_L-elsbetiae_contig5621.13960.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5621.13960.1 vs. uniprot
Match: D7G3T7_ECTSI (Peptidase A1 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3T7_ECTSI) HSP 1 Score: 130 bits (328), Expect = 1.740e-32 Identity = 56/81 (69.14%), Postives = 62/81 (76.54%), Query Frame = 0 Query: 158 RLPLRSSIGTHFVYAHVGTPPQRVRLIIDTGSYTTAFPCVGCSKCRPGSTAPFWDPALSETVSAVPCEGCRGGYKCSKFEP 238 R PLR S GTHFVYAHVGTPPQRV LI+DTGS+T AFPCVGC KCRP S PFWDP S T + + C+ C G Y CS+FEP Sbjct: 82 RFPLRWSEGTHFVYAHVGTPPQRVSLIVDTGSFTLAFPCVGCDKCRPRSRTPFWDPGASATAAELSCDECHGDYTCSEFEP 162
BLAST of mRNA_L-elsbetiae_contig5621.13960.1 vs. uniprot
Match: A0A6H5LN99_9PHAE (Peptidase A1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LN99_9PHAE) HSP 1 Score: 129 bits (323), Expect = 2.140e-30 Identity = 55/81 (67.90%), Postives = 62/81 (76.54%), Query Frame = 0 Query: 158 RLPLRSSIGTHFVYAHVGTPPQRVRLIIDTGSYTTAFPCVGCSKCRPGSTAPFWDPALSETVSAVPCEGCRGGYKCSKFEP 238 R+PLR S GTHFVYAHVGTPPQRV LI+DTGS+ AFPCVGC KCRP S PFWDP S T + + C+ C G Y CS+FEP Sbjct: 151 RIPLRWSEGTHFVYAHVGTPPQRVSLILDTGSFMLAFPCVGCDKCRPRSRTPFWDPGASATAAELSCDECHGDYTCSEFEP 231
BLAST of mRNA_L-elsbetiae_contig5621.13960.1 vs. uniprot
Match: A0A7S2FBW1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2FBW1_9STRA) HSP 1 Score: 82.8 bits (203), Expect = 7.800e-17 Identity = 39/76 (51.32%), Postives = 49/76 (64.47%), Query Frame = 0 Query: 153 ADIATRLPLRSSIGTHFVYAHVGTPPQRVRLIIDTGSYTTAFPCVGCSKCRPGSTAPFWDPALSETVSAVPCEGCR 228 A A+ PL IGTH+V+ +VGTPPQRV +I+DTGS+ TAFPC GC C T P++DP S T V C C+ Sbjct: 26 APAASEAPLWEGIGTHYVHIYVGTPPQRVSVIVDTGSHHTAFPCDGCKNCGK-HTDPYFDPKKSSTSQTVGCSQCK 100
BLAST of mRNA_L-elsbetiae_contig5621.13960.1 vs. uniprot
Match: A0A6H5JRT4_9PHAE (Peptidase A1 domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JRT4_9PHAE) HSP 1 Score: 88.6 bits (218), Expect = 1.850e-16 Identity = 39/76 (51.32%), Postives = 47/76 (61.84%), Query Frame = 0 Query: 160 PLRSSIGTHFVYAHVGTPPQRVRLIIDTGSYTTAFPCVGCSKCRPGSTAPFWDPALSETVSAVPCEGCRGGYKCSK 235 PL GTHF Y + GTPPQRV +IIDTGS+ TAFPC GC C T P WD + S + V CE C G ++C + Sbjct: 118 PLFPGWGTHFAYVYAGTPPQRVSVIIDTGSHFTAFPCSGCKNCG-SHTDPHWDQSKSTSSHIVTCEDCHGSFRCQR 192
BLAST of mRNA_L-elsbetiae_contig5621.13960.1 vs. uniprot
Match: A0A7S2WCI1_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WCI1_9STRA) HSP 1 Score: 88.2 bits (217), Expect = 2.070e-16 Identity = 39/77 (50.65%), Postives = 51/77 (66.23%), Query Frame = 0 Query: 159 LPLRSSIGTHFVYAHVGTPPQRVRLIIDTGSYTTAFPCVGCSKCRPGSTAPFWDPALSETVSAVPCEGCRGGYKCSK 235 +PL IGTH+ + +VGTPPQRV +I+DTGS+ TAFPC GC C T P + P+ S T S +PC C+ G +C K Sbjct: 78 IPLFEGIGTHYAFIYVGTPPQRVSVIMDTGSHLTAFPCEGCKTCG-SHTDPHFKPSGSSTNSYLPCNACKAGARCVK 153
BLAST of mRNA_L-elsbetiae_contig5621.13960.1 vs. uniprot
Match: A0A836CAB1_9STRA (Aspartic peptidase domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CAB1_9STRA) HSP 1 Score: 82.4 bits (202), Expect = 7.690e-16 Identity = 36/72 (50.00%), Postives = 43/72 (59.72%), Query Frame = 0 Query: 166 GTHFVYAHVGTPPQRVRLIIDTGSYTTAFPCVGCSKCRPGSTAPFWDPALSETVSAVPCEGCRGGYKCSKFE 237 GTH Y +VGTPPQRV +I+DTGS TAFPC GC C P+WD + S T C+ C G Y C+ E Sbjct: 3 GTHVAYVYVGTPPQRVSVILDTGSSNTAFPCTGCQGCGQHED-PYWDRSASSTAQVSSCQQCVGDYTCTAAE 73
BLAST of mRNA_L-elsbetiae_contig5621.13960.1 vs. uniprot
Match: A0A835ZJF3_9STRA (Aspartic peptidase domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZJF3_9STRA) HSP 1 Score: 84.7 bits (208), Expect = 3.760e-15 Identity = 37/68 (54.41%), Postives = 43/68 (63.24%), Query Frame = 0 Query: 166 GTHFVYAHVGTPPQRVRLIIDTGSYTTAFPCVGCSKCRPGSTAPFWDPALSETVSAVPCEGCRGGYKC 233 GTH Y +VGTPPQRV +IIDTGS+ TAFPC GC C T P+WD A S T C C+G + C Sbjct: 8 GTHIAYLYVGTPPQRVSVIIDTGSHLTAFPCKGCQACGK-HTDPYWDFAASSTAKITTCAACKGTFTC 74
BLAST of mRNA_L-elsbetiae_contig5621.13960.1 vs. uniprot
Match: A0A835ZHP7_9STRA (Aspartic peptidase domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZHP7_9STRA) HSP 1 Score: 84.0 bits (206), Expect = 5.680e-15 Identity = 37/75 (49.33%), Postives = 45/75 (60.00%), Query Frame = 0 Query: 159 LPLRSSIGTHFVYAHVGTPPQRVRLIIDTGSYTTAFPCVGCSKCRPGSTAPFWDPALSETVSAVPCEGCRGGYKC 233 +PL GTH Y +VGTPPQRV +I+DTGS+ TAFPC GC C T +WD LS T + C C G + C Sbjct: 6 VPLIPGYGTHIAYVYVGTPPQRVSVILDTGSHFTAFPCKGCKACG-DHTDSYWDFDLSSTATLTKCPDCHGNFNC 79
BLAST of mRNA_L-elsbetiae_contig5621.13960.1 vs. uniprot
Match: F0YC49_AURAN (Peptidase A1 domain-containing protein (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YC49_AURAN) HSP 1 Score: 79.0 bits (193), Expect = 1.540e-14 Identity = 34/69 (49.28%), Postives = 45/69 (65.22%), Query Frame = 0 Query: 165 IGTHFVYAHVGTPPQRVRLIIDTGSYTTAFPCVGCSKCRPGSTAPFWDPALSETVSAVPCEGCRGGYKC 233 IGTH+ + +VGTPPQRV +I+DTGS+ TAFPC GC C T P++DP S T+ + C C +C Sbjct: 3 IGTHYAHVYVGTPPQRVSVIVDTGSHHTAFPCSGCKSCGK-HTDPYFDPDKSSTLRRLGCSDCVAAARC 70
BLAST of mRNA_L-elsbetiae_contig5621.13960.1 vs. uniprot
Match: A0A4D9CR18_9STRA (Peptidase A1 domain-containing protein n=2 Tax=Monodopsidaceae TaxID=425072 RepID=A0A4D9CR18_9STRA) HSP 1 Score: 80.1 bits (196), Expect = 1.440e-13 Identity = 35/75 (46.67%), Postives = 45/75 (60.00%), Query Frame = 0 Query: 159 LPLRSSIGTHFVYAHVGTPPQRVRLIIDTGSYTTAFPCVGCSKCRPGSTAPFWDPALSETVSAVPCEGCRGGYKC 233 LPL + GTH+ + VGTP QRV +I+DTGS+ TAFPC GC C T P +D S+T A+ C C+ C Sbjct: 102 LPLHAGYGTHYAFVFVGTPAQRVSVILDTGSHWTAFPCTGCQMCGDDHTDPVFDVLKSDTFHALDCSECKFSGHC 176 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5621.13960.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5621.13960.1 ID=prot_L-elsbetiae_contig5621.13960.1|Name=mRNA_L-elsbetiae_contig5621.13960.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=239bpback to top |