prot_L-elsbetiae_contig5589.13906.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5589.13906.1 vs. uniprot
Match: A0A6H5JK37_9PHAE (Protein kinase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JK37_9PHAE) HSP 1 Score: 54.3 bits (129), Expect = 2.270e-7 Identity = 26/36 (72.22%), Postives = 29/36 (80.56%), Query Frame = 0 Query: 1 MTYVVSKGLKSAEQAWLLLSAARDPACHVSAATCGR 36 MT+ +GLKS E+AWLLLSAARDP CH SAA CGR Sbjct: 235 MTFAAMRGLKS-ERAWLLLSAARDPTCHASAAACGR 269
BLAST of mRNA_L-elsbetiae_contig5589.13906.1 vs. uniprot
Match: D8LN78_ECTSI (Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LN78_ECTSI) HSP 1 Score: 54.3 bits (129), Expect = 2.270e-7 Identity = 26/36 (72.22%), Postives = 29/36 (80.56%), Query Frame = 0 Query: 1 MTYVVSKGLKSAEQAWLLLSAARDPACHVSAATCGR 36 MT+ +GLKS E+AWLLLSAARDP CH SAA CGR Sbjct: 257 MTFAAMRGLKS-ERAWLLLSAARDPTCHASAAACGR 291 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5589.13906.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5589.13906.1 ID=prot_L-elsbetiae_contig5589.13906.1|Name=mRNA_L-elsbetiae_contig5589.13906.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=42bpback to top |