mRNA_L-elsbetiae_contig5589.13906.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5589.13906.1 vs. uniprot
Match: A0A6H5JK37_9PHAE (Protein kinase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JK37_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 1.490e-8 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 1 Query: 1 QVMTYVVSKGLKSAEQAWLLLSAARDPACHVSAATCGR 114 QVMT+ +GLKS E+AWLLLSAARDP CH SAA CGR Sbjct: 233 QVMTFAAMRGLKS-ERAWLLLSAARDPTCHASAAACGR 269
BLAST of mRNA_L-elsbetiae_contig5589.13906.1 vs. uniprot
Match: D8LN78_ECTSI (Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LN78_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 1.490e-8 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 1 Query: 1 QVMTYVVSKGLKSAEQAWLLLSAARDPACHVSAATCGR 114 QVMT+ +GLKS E+AWLLLSAARDP CH SAA CGR Sbjct: 255 QVMTFAAMRGLKS-ERAWLLLSAARDPTCHASAAACGR 291 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5589.13906.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5589.13906.1 >prot_L-elsbetiae_contig5589.13906.1 ID=prot_L-elsbetiae_contig5589.13906.1|Name=mRNA_L-elsbetiae_contig5589.13906.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=42bp MTYVVSKGLKSAEQAWLLLSAARDPACHVSAATCGRRVKVT*back to top mRNA from alignment at L-elsbetiae_contig5589:406..537+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5589.13906.1 ID=mRNA_L-elsbetiae_contig5589.13906.1|Name=mRNA_L-elsbetiae_contig5589.13906.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=132bp|location=Sequence derived from alignment at L-elsbetiae_contig5589:406..537+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5589:406..537+ >mRNA_L-elsbetiae_contig5589.13906.1 ID=mRNA_L-elsbetiae_contig5589.13906.1|Name=mRNA_L-elsbetiae_contig5589.13906.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=252bp|location=Sequence derived from alignment at L-elsbetiae_contig5589:406..537+ (Laminarionema elsbetiae ELsaHSoW15)back to top |