prot_L-elsbetiae_contig5583.13900.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5583.13900.1 vs. uniprot
Match: D7FRV9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FRV9_ECTSI) HSP 1 Score: 62.4 bits (150), Expect = 4.050e-9 Identity = 28/74 (37.84%), Postives = 41/74 (55.41%), Query Frame = 0 Query: 5 PEFKNLWERPEVCPPNWASGEKEALNLNGVHPELVRCVDHVFVRGCEAEFLGGLVETSSGSCPTKKPDAAGGNG 78 P F+ L + PEVC P G A +H L+RC++ V++RGCE +LG +V+ G CP ++P G G Sbjct: 179 PGFEQLGDNPEVCRPQMEDGADNAFGYEHIHSRLLRCMNRVYLRGCEKAYLGKMVDLE-GFCPKQEPGKRKGAG 251 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5583.13900.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5583.13900.1 ID=prot_L-elsbetiae_contig5583.13900.1|Name=mRNA_L-elsbetiae_contig5583.13900.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=106bpback to top |