prot_L-elsbetiae_contig5448.13697.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5448.13697.1 vs. uniprot
Match: D7FUU6_ECTSI (Small heat shock protein heat shock protein 20 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUU6_ECTSI) HSP 1 Score: 75.9 bits (185), Expect = 3.250e-14 Identity = 39/67 (58.21%), Postives = 49/67 (73.13%), Query Frame = 0 Query: 1 MNDIFESMEWDMLAPWGLAFRFPGKGGAFPAPPSSNDIVGNGGFS-NMNVDFHETSNGFELIADLPG 66 +ND+F S+E +MLAPWGLA RFP FP P+S + G+G S M++DFHET +GFELIADLPG Sbjct: 20 INDVFGSIEREMLAPWGLASRFPTTRDMFPTFPTS--LFGDGSRSLGMSLDFHETKDGFELIADLPG 84
BLAST of mRNA_L-elsbetiae_contig5448.13697.1 vs. uniprot
Match: A0A6H5KKF0_9PHAE (HSP20 protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKF0_9PHAE) HSP 1 Score: 62.8 bits (151), Expect = 1.790e-9 Identity = 34/56 (60.71%), Postives = 40/56 (71.43%), Query Frame = 0 Query: 12 MLAPWGLAFRFPGKGGAFPAPPSSNDIVGNGGFS-NMNVDFHETSNGFELIADLPG 66 MLAPWGLAFRFP P+ SS + +G S +MN+DFHET +GFELIADLPG Sbjct: 1 MLAPWGLAFRFPTARDMVPSVSSS--LFRDGSRSLDMNLDFHETKDGFELIADLPG 54
BLAST of mRNA_L-elsbetiae_contig5448.13697.1 vs. uniprot
Match: A0A6H5JPQ3_9PHAE (HSP20 protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPQ3_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 2.690e-8 Identity = 32/56 (57.14%), Postives = 38/56 (67.86%), Query Frame = 0 Query: 12 MLAPWGLAFRFPGKGGAFPAPPSSNDIVGNGGFS-NMNVDFHETSNGFELIADLPG 66 MLAPWG A RFP P+ SS + +G S +MN+DFHET +GFELIADLPG Sbjct: 1 MLAPWGFASRFPTARDMVPSVSSS--LFRDGSRSLDMNLDFHETKDGFELIADLPG 54
BLAST of mRNA_L-elsbetiae_contig5448.13697.1 vs. uniprot
Match: A0A6H5JFM4_9PHAE (HSP20 protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFM4_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 1.310e-5 Identity = 36/105 (34.29%), Postives = 47/105 (44.76%), Query Frame = 0 Query: 1 MNDIFESMEWDMLAPWGLAFRFPGKG--------------------------------------GAFPAPPSSNDIVGNGGFS-NMNVDFHETSNGFELIADLPG 66 ++D+F S+E +MLAPWGLA RFP P S+ + +G S +MN+DFHET +GFELIADLPG Sbjct: 5 IDDVFGSIEREMLAPWGLASRFPTASHMRYSTLRVHTKXXXXXXXXXXXXXXXXXXXXXXXXXXXRDMVPSVSSSLFRDGSRSLDMNLDFHETKDGFELIADLPG 109 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5448.13697.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5448.13697.1 ID=prot_L-elsbetiae_contig5448.13697.1|Name=mRNA_L-elsbetiae_contig5448.13697.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=141bpback to top |