prot_L-elsbetiae_contig5356.13539.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5356.13539.1 vs. uniprot
Match: D7G9E6_ECTSI (ELM2 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G9E6_ECTSI) HSP 1 Score: 77.0 bits (188), Expect = 7.530e-12 Identity = 34/75 (45.33%), Postives = 50/75 (66.67%), Query Frame = 0 Query: 105 VEDPGLLEDWTKQQVASLMEAIKNEINIAGFARSTGHEKHLDEHIDLNRLLHTVEGKTPSQILAFYYKSIQENDA 179 V+D G L WT Q+ +L +A++ + F RS GHE+H DEH D+ L+ +V+GKTPSQ+L+FYY+ + DA Sbjct: 422 VDDSGPLATWTGPQIEALSKALETHFDADRFTRSRGHERHRDEHTDVTSLIASVDGKTPSQVLSFYYRYMATGDA 496
BLAST of mRNA_L-elsbetiae_contig5356.13539.1 vs. uniprot
Match: A0A6H5K2H5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2H5_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 3.050e-11 Identity = 34/75 (45.33%), Postives = 50/75 (66.67%), Query Frame = 0 Query: 105 VEDPGLLEDWTKQQVASLMEAIKNEINIAGFARSTGHEKHLDEHIDLNRLLHTVEGKTPSQILAFYYKSIQENDA 179 V+D G L WT Q+ +L +A++ + F RS GHE+H DEH D+ L+ +V+GKTPSQ+L+FYY+ + DA Sbjct: 573 VDDSGPLATWTGPQIEALSKALEANFDPDRFTRSRGHERHRDEHTDVTSLIASVDGKTPSQVLSFYYRYMATGDA 647 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5356.13539.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5356.13539.1 ID=prot_L-elsbetiae_contig5356.13539.1|Name=mRNA_L-elsbetiae_contig5356.13539.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=331bpback to top |