prot_L-elsbetiae_contig535.13530.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig535.13530.1 vs. uniprot
Match: D7G080_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G080_ECTSI) HSP 1 Score: 54.3 bits (129), Expect = 5.860e-7 Identity = 31/56 (55.36%), Postives = 34/56 (60.71%), Query Frame = 0 Query: 23 AAAASAWDPGNVVYVGMEYSNMGACSQKAPAS---FQPGNFAG---GCSQNKMAVP 72 A AA WD +V YVGMEYSN GACSQK A+ + G A GCSQNK A P Sbjct: 22 ATAAVPWDSDSVAYVGMEYSNKGACSQKRSAAVDFYGGGGTASTGRGCSQNKAAAP 77 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig535.13530.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig535.13530.1 ID=prot_L-elsbetiae_contig535.13530.1|Name=mRNA_L-elsbetiae_contig535.13530.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=107bpback to top |