prot_L-elsbetiae_contig52.13286.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig52.13286.1 vs. uniprot
Match: D7FNC2_ECTSI (C3H1-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNC2_ECTSI) HSP 1 Score: 69.3 bits (168), Expect = 1.630e-10 Identity = 35/40 (87.50%), Postives = 37/40 (92.50%), Query Frame = 0 Query: 94 HETDDISDILGVGLGGLPTLSSSGQLSVLSASAVEFTPGG 133 HETDDISDIL VGLGGLPTLS+SGQLS+LSASA EF PGG Sbjct: 31 HETDDISDILNVGLGGLPTLSASGQLSILSASAQEFKPGG 70
BLAST of mRNA_L-elsbetiae_contig52.13286.1 vs. uniprot
Match: A0A6H5JKG2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKG2_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 3.080e-10 Identity = 35/41 (85.37%), Postives = 37/41 (90.24%), Query Frame = 0 Query: 94 HETDDISDILGVGLGGLPTLSSSGQLSVLSASAVEFTPGGQ 134 HETDDISDIL VGLGGLPTLS+ GQLS+LSASA EF PGGQ Sbjct: 31 HETDDISDILNVGLGGLPTLSALGQLSILSASAQEFKPGGQ 71 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig52.13286.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig52.13286.1 ID=prot_L-elsbetiae_contig52.13286.1|Name=mRNA_L-elsbetiae_contig52.13286.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=182bpback to top |