prot_L-elsbetiae_contig2102.6372.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2102.6372.1 vs. uniprot
Match: D7FU85_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FU85_ECTSI) HSP 1 Score: 109 bits (272), Expect = 9.710e-29 Identity = 52/56 (92.86%), Postives = 55/56 (98.21%), Query Frame = 0 Query: 84 QVLLGVTTICAICAIPVLRPNRPKPGHGLFDSEKPQAVELAQEEARRKKLNIGDRT 139 +V +GVTTICAICAIPVLRPNRPKPGHGLFDSEKPQAVELAQEEARRKKLN+GDRT Sbjct: 20 KVFVGVTTICAICAIPVLRPNRPKPGHGLFDSEKPQAVELAQEEARRKKLNVGDRT 75
BLAST of mRNA_L-elsbetiae_contig2102.6372.1 vs. uniprot
Match: A0A835ZBU4_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZBU4_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 5.950e-10 Identity = 28/52 (53.85%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 84 QVLLGVTTICAICAIPVLRPNRPKPGHGLFDSEKPQAVELAQEEARRKKLNI 135 Q L+G +CAICAIP++ + KPGHGLFDSEKPQ +E AQ+ R+ L + Sbjct: 16 QALVGTAIVCAICAIPMIN-RKTKPGHGLFDSEKPQEIEQAQDAQRKATLGV 66 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2102.6372.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig2102.6372.1 ID=prot_L-elsbetiae_contig2102.6372.1|Name=mRNA_L-elsbetiae_contig2102.6372.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=140bpback to top |