prot_L-elsbetiae_contig207.6241.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig207.6241.1 vs. uniprot
Match: D7FHS6_ECTSI (Heat shock protein 40 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHS6_ECTSI) HSP 1 Score: 101 bits (251), Expect = 5.300e-23 Identity = 54/90 (60.00%), Postives = 65/90 (72.22%), Query Frame = 0 Query: 5 GASNKRGSLIVEFEVKFPPRLREAHLAALRVVLTENEIAVLEDVLKLMSARKGKHHWPEMGPEEYRFTHFCSTEGDGYDGYGDTSHPQCI 94 G RGSL+++FEV FP RLREAHLAALRVVLTE EIA+LEDVLKLMS RK K P M P EY +T CS++ D D + S+P+C+ Sbjct: 422 GGDGDRGSLVIDFEVDFPSRLREAHLAALRVVLTEEEIALLEDVLKLMSTRKSKAR-PPMEPLEYLYTRICSSD-DEDDFINNGSNPRCV 509 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig207.6241.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig207.6241.1 ID=prot_L-elsbetiae_contig207.6241.1|Name=mRNA_L-elsbetiae_contig207.6241.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=95bpback to top |