prot_L-elsbetiae_contig20243.6092.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig20243.6092.1 vs. uniprot
Match: D7FZN4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZN4_ECTSI) HSP 1 Score: 71.6 bits (174), Expect = 1.610e-11 Identity = 42/119 (35.29%), Postives = 59/119 (49.58%), Query Frame = 0 Query: 10 SGRSRKPVDRFVDNFVVVDKKKPPKIAKGKGTAFKDFSTWRRSCGALAPVGSCVGCTGSLLGARSRYRNAYLGQVLNFSGIPNEKPLHKVTLGLEGQTRTSCVKWKLGKLAELLDFLEV 128 SGR RK +DR DN+ KK +IAKG G+A +D G L +G +LL + Q+L FSGIP+++ L KVT L+ + KW + + E +D LEV Sbjct: 240 SGRKRKSIDRLGDNYAAAQDKKSVEIAKGAGSALEDIPNVAEKLGRLTRNSHMIGLLHNLLFGGKMKKTELKAQLLQFSGIPDDEALDKVTSRLDSK------KWPVPMVKEAMDLLEV 352 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig20243.6092.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig20243.6092.1 ID=prot_L-elsbetiae_contig20243.6092.1|Name=mRNA_L-elsbetiae_contig20243.6092.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=170bpback to top |