prot_L-elsbetiae_contig2020.6075.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2020.6075.1 vs. uniprot
Match: D7G1Z1_ECTSI (C2H2 and CCCH zinc finger protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G1Z1_ECTSI) HSP 1 Score: 109 bits (272), Expect = 1.720e-28 Identity = 48/72 (66.67%), Postives = 59/72 (81.94%), Query Frame = 0 Query: 10 NTGGLYLGPVRRPLNADCEFFDAGNINRALLCKINVFAIISGGGDAMDFDDHQRSYGCMFHNCSSTFSSLRR 81 +TGGLYLGPV RPL++D EFFD GN NRALLCK+NVFAI+S G DAMD + Q + CMF +C++TFSSL+R Sbjct: 8 STGGLYLGPVLRPLSSDSEFFDEGNTNRALLCKLNVFAIMSEGADAMDLHEDQHQFECMFQDCTATFSSLKR 79 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2020.6075.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig2020.6075.1 ID=prot_L-elsbetiae_contig2020.6075.1|Name=mRNA_L-elsbetiae_contig2020.6075.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=86bpback to top |