prot_L-elsbetiae_contig2012.6053.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2012.6053.1 vs. uniprot
Match: D7FT14_ECTSI (Putative AAA family ATP ase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FT14_ECTSI) HSP 1 Score: 60.1 bits (144), Expect = 1.800e-8 Identity = 31/49 (63.27%), Postives = 34/49 (69.39%), Query Frame = 0 Query: 36 YGHSRCSNYYEDEGVMRAGAHGPIPPRLPNGSGLVRKRKRVPLGRLDNN 84 YG S+ ++DE R G PIPPRLPNG GLVRKRK VP GRLDNN Sbjct: 109 YGRYGRSSSFDDEANTRGGQGPPIPPRLPNGPGLVRKRKFVPPGRLDNN 157
BLAST of mRNA_L-elsbetiae_contig2012.6053.1 vs. uniprot
Match: A0A6H5JMF7_9PHAE (AAA domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMF7_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 6.970e-6 Identity = 30/50 (60.00%), Postives = 33/50 (66.00%), Query Frame = 0 Query: 37 GHSR---CSNYYEDEGVMRAGAHGPIPPRLPNGSGLVRKRKRVPLGRLDN 83 GH R S+ ++DE R G IPPRLPNG GLVRKRK VP GRLDN Sbjct: 387 GHGRYGSSSSSFDDEVNTRGGQGPSIPPRLPNGPGLVRKRKFVPPGRLDN 436 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2012.6053.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig2012.6053.1 ID=prot_L-elsbetiae_contig2012.6053.1|Name=mRNA_L-elsbetiae_contig2012.6053.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=95bpback to top |