prot_L-elsbetiae_contig19247.5694.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19247.5694.1 vs. uniprot
Match: A0A6H5KG45_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KG45_9PHAE) HSP 1 Score: 109 bits (273), Expect = 1.720e-26 Identity = 50/57 (87.72%), Postives = 53/57 (92.98%), Query Frame = 0 Query: 1 QEVDVVFEEDVGFLGALRDLRRGAKCPVVLTAESYRHEYAPLSCNIWFLPRPRLVEV 57 +EVDVVFEEDVGFLGALRDLRR AKCPV+LTAE+YR EYAPLSCNIW LPRPRL EV Sbjct: 17 EEVDVVFEEDVGFLGALRDLRRAAKCPVILTAETYRREYAPLSCNIWHLPRPRLAEV 73
BLAST of mRNA_L-elsbetiae_contig19247.5694.1 vs. uniprot
Match: D7FH97_ECTSI (Similar to chromosome fragility associated gene 1 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH97_ECTSI) HSP 1 Score: 108 bits (270), Expect = 4.380e-26 Identity = 49/57 (85.96%), Postives = 53/57 (92.98%), Query Frame = 0 Query: 1 QEVDVVFEEDVGFLGALRDLRRGAKCPVVLTAESYRHEYAPLSCNIWFLPRPRLVEV 57 +EVDVVFEEDVGFLGALRDLRR AKCPV+LTAE+YR EYAPLSCNIW LPRPRL E+ Sbjct: 1025 EEVDVVFEEDVGFLGALRDLRRAAKCPVILTAETYRREYAPLSCNIWHLPRPRLAEL 1081 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19247.5694.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig19247.5694.1 ID=prot_L-elsbetiae_contig19247.5694.1|Name=mRNA_L-elsbetiae_contig19247.5694.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=62bpback to top |