prot_L-elsbetiae_contig19088.5620.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19088.5620.1 vs. uniprot
Match: A0A6H5KJX9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJX9_9PHAE) HSP 1 Score: 69.3 bits (168), Expect = 1.870e-10 Identity = 56/99 (56.57%), Postives = 64/99 (64.65%), Query Frame = 0 Query: 80 MTMATPAPVYRGGGXXXXX-ALF-----GXXXXXXXXDRAIFFGRVEDGLTT-LGLTVGISRSHVSHRPVSPQPKDMAIKIRTEDCGRIDVPTGAWADC 171 MTMATP PVYRG XXXXX A+F G XXXXXX FFGRVEDG+T L L + + R VSPQPKDM I++R ED G I+ P GAW +C Sbjct: 1087 MTMATPTPVYRGXXXXXXXXAVFAPPRAGVGXXXXXXGGLGFFGRVEDGITAFLVLALSVLRR------VSPQPKDMKIEVRPEDRGSIEAPVGAWIEC 1179 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19088.5620.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig19088.5620.1 ID=prot_L-elsbetiae_contig19088.5620.1|Name=mRNA_L-elsbetiae_contig19088.5620.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=182bpback to top |