prot_L-elsbetiae_contig1891.5555.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1891.5555.1 vs. uniprot
Match: D7FLU9_ECTSI (C6 transcription factor Prf n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLU9_ECTSI) HSP 1 Score: 72.8 bits (177), Expect = 6.190e-11 Identity = 34/58 (58.62%), Postives = 45/58 (77.59%), Query Frame = 0 Query: 1 MRKACDRCTMRKIKCDGTPIICKRCETDGQYCRYSPRAKSGPKPQTVRRTKSTPSSSR 58 +R +CDRCTMRKIKCDG C+RC+ D Q+C YS ++KSGPKP ++RR KS+P+ R Sbjct: 421 LRTSCDRCTMRKIKCDGREGKCQRCDRDNQFCHYSLKSKSGPKPNSIRR-KSSPTPPR 477
BLAST of mRNA_L-elsbetiae_contig1891.5555.1 vs. uniprot
Match: A0A6H5L603_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L603_9PHAE) HSP 1 Score: 71.6 bits (174), Expect = 1.630e-10 Identity = 34/55 (61.82%), Postives = 43/55 (78.18%), Query Frame = 0 Query: 4 ACDRCTMRKIKCDGTPIICKRCETDGQYCRYSPRAKSGPKPQTVRRTKSTPSSSR 58 +CDRCTMRKIKCDG C+RC+ D Q+C YS ++KSGPKP ++RR KS+P S R Sbjct: 474 SCDRCTMRKIKCDGREGKCQRCDRDNQFCHYSLKSKSGPKPNSIRR-KSSPRSPR 527 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1891.5555.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1891.5555.1 ID=prot_L-elsbetiae_contig1891.5555.1|Name=mRNA_L-elsbetiae_contig1891.5555.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=260bpback to top |