Homology
The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig18819.5515.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 21..82 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 16..20 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..20 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 4..15 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..3 |
None | No IPR available | SIGNALP_EUK | SignalP-TM | SignalP-TM | coord: 1..20 score: 0.66 |
None | No IPR available | TMHMM | TMhelix | | coord: 4..26 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig18819.5515.1 ID=prot_L-elsbetiae_contig18819.5515.1|Name=mRNA_L-elsbetiae_contig18819.5515.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=83bp MNMVILALLLLLGLLPTALSIDFFFWRKKHKAKMGFGLLNTTTALGSNRA LGSSSLSEDQKPMRGSHEFDRIFARQFDTSAH* back to top
|