prot_L-elsbetiae_contig18267.5286.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig18267.5286.1 vs. uniprot
Match: D8LTJ4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LTJ4_ECTSI) HSP 1 Score: 90.1 bits (222), Expect = 2.870e-20 Identity = 40/51 (78.43%), Postives = 44/51 (86.27%), Query Frame = 0 Query: 1 VAADRNGNIFVGGQTDGNLFAPASAGDGQDIWVAKLDGAGGELLWGYQASA 51 VA DR+GNIFVGGQTDGNLFAP + GDGQDIWVAKL+G GG LLWGYQ + Sbjct: 82 VATDRSGNIFVGGQTDGNLFAPWTEGDGQDIWVAKLEGEGGGLLWGYQVGS 132
BLAST of mRNA_L-elsbetiae_contig18267.5286.1 vs. uniprot
Match: A0A6H5KWN4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWN4_9PHAE) HSP 1 Score: 90.1 bits (222), Expect = 8.300e-20 Identity = 40/51 (78.43%), Postives = 44/51 (86.27%), Query Frame = 0 Query: 1 VAADRNGNIFVGGQTDGNLFAPASAGDGQDIWVAKLDGAGGELLWGYQASA 51 VA DR+GNIFVGGQTDGNLFAP + GDGQDIWVAKL+G GG LLWGYQ + Sbjct: 78 VATDRSGNIFVGGQTDGNLFAPWTEGDGQDIWVAKLEGEGGGLLWGYQVGS 128
BLAST of mRNA_L-elsbetiae_contig18267.5286.1 vs. uniprot
Match: A0A1Y0RJM2_9CYAN (Uncharacterized protein n=1 Tax=Nostocales cyanobacterium HT-58-2 TaxID=1940762 RepID=A0A1Y0RJM2_9CYAN) HSP 1 Score: 47.8 bits (112), Expect = 7.030e-5 Identity = 22/48 (45.83%), Postives = 31/48 (64.58%), Query Frame = 0 Query: 1 VAADRNGNIFVGGQTDGNLFAPASAGDGQDIWVAKLDGAGGELLWGYQ 48 V D+ GN ++ G TDGNLF+ + D ++WVAK D + G+ LWG Q Sbjct: 283 VVTDKEGNFYLAGATDGNLFSSKQS-DELEVWVAKYD-SNGKQLWGKQ 328 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig18267.5286.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig18267.5286.1 ID=prot_L-elsbetiae_contig18267.5286.1|Name=mRNA_L-elsbetiae_contig18267.5286.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=51bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|