prot_L-elsbetiae_contig17663.4989.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17663.4989.1 vs. uniprot
Match: B5LWN4_9PHYC (Putative ubiquitin-like putative cysteine protease n=1 Tax=Feldmannia species virus TaxID=39420 RepID=B5LWN4_9PHYC) HSP 1 Score: 51.6 bits (122), Expect = 2.910e-5 Identity = 37/112 (33.04%), Postives = 50/112 (44.64%), Query Frame = 0 Query: 2 VIEVENKVLKCYDSLNYPCGVVTAGLKKWLEDILEDDYYKGRWKDIFPHEWRVMDQTQTGTSDLQRNDRDCGVFTLAFANKISKHEDLGDVAQIAMGGARKKIASQIIEGSL 113 V++ K + CYDSL+ VV +K+W I D +W T+ GTS LQ N DCGVF A +S L +Q M R++IA I+ G L Sbjct: 217 VVDNGKKKVSCYDSLHRRHIVVLRNIKRWAHSIYGTD------------DWT----TEYGTSPLQLNTDDCGVFVCINAALLSNKRKL-KYSQEHMAAFRQRIARSIVNGRL 311 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17663.4989.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig17663.4989.1 ID=prot_L-elsbetiae_contig17663.4989.1|Name=mRNA_L-elsbetiae_contig17663.4989.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=114bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|