prot_L-elsbetiae_contig17424.4892.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17424.4892.1 vs. uniprot
Match: A0A6H5JW94_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JW94_9PHAE) HSP 1 Score: 56.2 bits (134), Expect = 1.050e-6 Identity = 26/42 (61.90%), Postives = 30/42 (71.43%), Query Frame = 0 Query: 1 MVNVAKKGCAHPGCTKQPSYGKAGSK-PEYCSGHAKDGMVVV 41 M NV K C HPGCTK+PS+G AGSK E+C HAK MV+V Sbjct: 1 MFNVVDKRCGHPGCTKKPSFGTAGSKRAEFCCPHAKQDMVIV 42 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17424.4892.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig17424.4892.1 ID=prot_L-elsbetiae_contig17424.4892.1|Name=mRNA_L-elsbetiae_contig17424.4892.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=239bpback to top |