prot_L-elsbetiae_contig17386.4869.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17386.4869.1 vs. uniprot
Match: A0A6H5JLY2_9PHAE (MYB protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLY2_9PHAE) HSP 1 Score: 67.8 bits (164), Expect = 8.580e-11 Identity = 38/61 (62.30%), Postives = 42/61 (68.85%), Query Frame = 0 Query: 59 EAMAGCSPASLSSPMSSGSGDGDG-ASSNGAFEPNLSLDKFMETLDALSPDGEQLHVHKRQ 118 E M GCSPASL+SPMS G A S GAFE N SLDKFME+L SPDG+ LH+ KRQ Sbjct: 17 EEMVGCSPASLNSPMSGGXXXXXXRARSGGAFESNYSLDKFMESLGTFSPDGQPLHLDKRQ 77
BLAST of mRNA_L-elsbetiae_contig17386.4869.1 vs. uniprot
Match: D8LCS2_ECTSI (Myb-like DNA-binding domain containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LCS2_ECTSI) HSP 1 Score: 57.4 bits (137), Expect = 3.730e-7 Identity = 26/36 (72.22%), Postives = 29/36 (80.56%), Query Frame = 0 Query: 83 ASSNGAFEPNLSLDKFMETLDALSPDGEQLHVHKRQ 118 ASS GAFEPN SLDKFME+L SPDG+ LH+ KRQ Sbjct: 12 ASSGGAFEPNYSLDKFMESLGTFSPDGQPLHLDKRQ 47 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17386.4869.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig17386.4869.1 ID=prot_L-elsbetiae_contig17386.4869.1|Name=mRNA_L-elsbetiae_contig17386.4869.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=118bpback to top |