prot_L-elsbetiae_contig17033.4714.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17033.4714.1 vs. uniprot
Match: D7FTZ3_ECTSI (EDR2_C domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FTZ3_ECTSI) HSP 1 Score: 88.6 bits (218), Expect = 4.130e-19 Identity = 40/47 (85.11%), Postives = 44/47 (93.62%), Query Frame = 0 Query: 5 QVGLPSMFARFSGKPILLYGKESSMVRGPGFAELDLNAHAFSYVGRK 51 +VGLPS+ RFSGKPILLYGKESSMV+GPG+ ELDLNAHAFSYVGRK Sbjct: 1113 EVGLPSIARRFSGKPILLYGKESSMVKGPGYVELDLNAHAFSYVGRK 1159
BLAST of mRNA_L-elsbetiae_contig17033.4714.1 vs. uniprot
Match: A0A835Z8Q7_9STRA (EDR2_C domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z8Q7_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 2.870e-8 Identity = 27/47 (57.45%), Postives = 35/47 (74.47%), Query Frame = 0 Query: 6 VGLPSMFARFSGKPILLYGKESSMVR--GPGFAELDLNAHAFSYVGR 50 VGLPS +F+ +PIL++G+ESS R G AELD+NAH FSY+GR Sbjct: 405 VGLPSFCRKFNARPILIHGRESSFTRDVAKGRAELDVNAHNFSYIGR 451 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17033.4714.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig17033.4714.1 ID=prot_L-elsbetiae_contig17033.4714.1|Name=mRNA_L-elsbetiae_contig17033.4714.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=59bpback to top |