prot_L-elsbetiae_contig16741.4552.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig16741.4552.1 vs. uniprot
Match: A0A6H5KQ38_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQ38_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 1.310e-12 Identity = 33/37 (89.19%), Postives = 34/37 (91.89%), Query Frame = 0 Query: 2 AERAAWNSTASCVVVGDVSGRLHFVTGDGTLIFSQPL 38 AE AAWNSTASCVVVGD SGRLHFVT +GTLIFSQPL Sbjct: 42 AECAAWNSTASCVVVGDASGRLHFVTPEGTLIFSQPL 78
BLAST of mRNA_L-elsbetiae_contig16741.4552.1 vs. uniprot
Match: D8LSU3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSU3_ECTSI) HSP 1 Score: 68.2 bits (165), Expect = 2.430e-12 Identity = 32/37 (86.49%), Postives = 33/37 (89.19%), Query Frame = 0 Query: 2 AERAAWNSTASCVVVGDVSGRLHFVTGDGTLIFSQPL 38 AE AWNSTASCVVVGD SGRLHFVT +GTLIFSQPL Sbjct: 156 AECGAWNSTASCVVVGDASGRLHFVTAEGTLIFSQPL 192
BLAST of mRNA_L-elsbetiae_contig16741.4552.1 vs. uniprot
Match: A0A835ZDW9_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZDW9_9STRA) HSP 1 Score: 53.1 bits (126), Expect = 4.800e-7 Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 0 Query: 1 AAERAAWNSTASCVVVGDVSGRLHFVTGDGTLIFSQPL 38 AAE W+STAS +V+GD +G+LHF DGTL+FSQPL Sbjct: 114 AAECGDWDSTASYLVIGDCTGKLHFYLADGTLLFSQPL 151 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig16741.4552.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig16741.4552.1 ID=prot_L-elsbetiae_contig16741.4552.1|Name=mRNA_L-elsbetiae_contig16741.4552.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=38bpback to top |