prot_L-elsbetiae_contig16534.4428.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig16534.4428.1 vs. uniprot
Match: A0A6H5L7B6_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L7B6_9PHAE) HSP 1 Score: 67.0 bits (162), Expect = 9.300e-9 Identity = 48/137 (35.04%), Postives = 71/137 (51.82%), Query Frame = 0 Query: 37 ATGHYFGSGRLMFDVPLGADIPLSQRYVQIGNGELLTATARGSLMMDFHQWDSEGQREDVRVLMRDVSVVEGLGPNLFSLHAVSVTHEITLDEYGTHVHGCITFPRNAAVASLYFTRVPQHAVSATLTAHSGFLPEF 173 A+ + S + MFD+ +IP +G+G LL A GS+ + F Q D G + + V + D+SVVE L NLFS+HAVS+ I DE G + + F + ++ Y R+P + SAT+ S LP F Sbjct: 253 ASNSFTNSSQHMFDLQ---EIPAI-----VGDGRLLEVQAIGSINLSFFQEDENGGKTTMCVKLTDLSVVESLSFNLFSMHAVSLKQHILHDERGATLQNGLLFAKEEKASAAYVMRLP-YDPSATVV-DSAALPAF 379 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig16534.4428.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig16534.4428.1 ID=prot_L-elsbetiae_contig16534.4428.1|Name=mRNA_L-elsbetiae_contig16534.4428.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=281bpback to top |