prot_L-elsbetiae_contig16148.4225.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig16148.4225.1 vs. uniprot
Match: D7G0H8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0H8_ECTSI) HSP 1 Score: 105 bits (261), Expect = 2.090e-25 Identity = 51/67 (76.12%), Postives = 59/67 (88.06%), Query Frame = 0 Query: 1 MSPLSAAAWLGKEDCLEAILETEGGLATLDMANNLGATPLLFACQENRKSIAEKLLAAGASLDASDV 67 +SPLSA AWLGKE CL+AIL TE GLATL++ NNLGATPL+FACQEN K IA+KL+AAGASLDA D+ Sbjct: 203 LSPLSATAWLGKEACLDAILGTERGLATLELTNNLGATPLIFACQENNKDIAKKLIAAGASLDAKDL 269
BLAST of mRNA_L-elsbetiae_contig16148.4225.1 vs. uniprot
Match: A0A6H5KW25_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KW25_9PHAE) HSP 1 Score: 90.9 bits (224), Expect = 1.810e-22 Identity = 46/67 (68.66%), Postives = 54/67 (80.60%), Query Frame = 0 Query: 1 MSPLSAAAWLGKEDCLEAILETEGGLATLDMANNLGATPLLFACQENRKSIAEKLLAAGASLDASDV 67 +S +SA WLGKE CL+ IL TE GL TL++ NNLGATPL+FACQEN K IA KL+AAGASLDA D+ Sbjct: 23 LSSVSATTWLGKEACLDPILGTERGLTTLELTNNLGATPLIFACQENNKGIA-KLIAAGASLDAKDL 88 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig16148.4225.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig16148.4225.1 ID=prot_L-elsbetiae_contig16148.4225.1|Name=mRNA_L-elsbetiae_contig16148.4225.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=68bpback to top |