prot_L-elsbetiae_contig1578.4028.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1578.4028.1 vs. uniprot
Match: A0A6H5L1V9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L1V9_9PHAE) HSP 1 Score: 58.5 bits (140), Expect = 1.450e-5 Identity = 30/63 (47.62%), Postives = 44/63 (69.84%), Query Frame = 0 Query: 13 SSRVSLVSARRLTWELPVEVLLQNAATELWSRVEFLQISDMTLSTETLSSIVWPKELKQLVLD 75 S+RV V A LTW P E L +A++ELW+R+E LQ+ ++L T L S+VWP+ L++LV+D Sbjct: 77 STRVPAVQAVGLTWARPTESPLGSASSELWTRLESLQLQ-VSLCTANLDSVVWPQGLQRLVMD 138 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1578.4028.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1578.4028.1 ID=prot_L-elsbetiae_contig1578.4028.1|Name=mRNA_L-elsbetiae_contig1578.4028.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=476bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|