prot_L-elsbetiae_contig15747.4013.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15747.4013.1 vs. uniprot
Match: A0A6H5L0S5_9PHAE (Uncharacterized protein (Fragment) n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0S5_9PHAE) HSP 1 Score: 62.8 bits (151), Expect = 1.430e-9 Identity = 33/97 (34.02%), Postives = 50/97 (51.55%), Query Frame = 0 Query: 29 GDSSLLRKFVGGNKPPVSPRDPNKRTGWLRVVERSLFDEGLGYTVEEDARTGPVRVIS-DSRDDLLQLHPQTIVLDHMRAYNYISNSVTGTDLDERL 124 G S L+ G PP P +P K W R + L EGL T++ TG V +I R+ L ++H +V H+RA+ Y+ S +G+D++E L Sbjct: 82 GGSQLMSGRFGTRNPPKHPNEPGKFMSWSRRMRTFLAVEGLEQTLDHQPPTGYVHIIGCPDRNYLNRIHGAPLVTAHLRAWGYLVESTSGSDIEETL 178
BLAST of mRNA_L-elsbetiae_contig15747.4013.1 vs. uniprot
Match: A0A6H5L089_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L089_9PHAE) HSP 1 Score: 62.8 bits (151), Expect = 5.690e-9 Identity = 33/97 (34.02%), Postives = 50/97 (51.55%), Query Frame = 0 Query: 29 GDSSLLRKFVGGNKPPVSPRDPNKRTGWLRVVERSLFDEGLGYTVEEDARTGPVRVIS-DSRDDLLQLHPQTIVLDHMRAYNYISNSVTGTDLDERL 124 G S L+ G PP P +P K W R + L EGL T++ TG V +I R+ L ++H +V H+RA+ Y+ S +G+D++E L Sbjct: 368 GGSQLMSGRFGTRNPPKHPNEPGKFMSWSRRMRTFLAVEGLEQTLDHQPPTGYVHIIGCPDRNYLNRIHGAPLVTAHLRAWGYLVESTSGSDIEETL 464 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15747.4013.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig15747.4013.1 ID=prot_L-elsbetiae_contig15747.4013.1|Name=mRNA_L-elsbetiae_contig15747.4013.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=124bpback to top |